PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG395300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 664aa    MW: 72254.8 Da    PI: 6.4676
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG395300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.12e-20105161157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Pavir.7KG395300.1.p 105 KKRYHRHTQHQIQEMESFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 161
                          688999************************************************995 PP

2START207.45.6e-653055261206
                          HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          ela +a++elv++a+++ep+W         e +n++e+ + f+++ +      ++ea+r+s vv+m++a+lve+l+d++ q+ +++    
  Pavir.7KG395300.1.p 305 ELAVAAMEELVQMAQLDEPLWNAPGvdgsiETLNEEEYSRMFSRGLGpkqygLKSEASRDSSVVIMTHANLVEILMDVN-QYATMFSsiv 393
                          57899****************987778889************988779*******************************.9999999999 PP

                          .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           +a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ +    v +++++pSg+li++++n
  Pavir.7KG395300.1.p 394 sRAATLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPGS----VLKCRRRPSGCLIQEMPN 479
                          9*****************************************************************97....8***************** PP

                          CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          g+skvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  Pavir.7KG395300.1.p 480 GYSKVTWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 526
                          *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.97E-2090162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2290146IPR009057Homeodomain-like
PROSITE profilePS5007117.022102162IPR001356Homeobox domain
SMARTSM003891.4E-19103166IPR001356Homeobox domain
CDDcd000861.61E-19105163No hitNo description
PfamPF000464.9E-18105160IPR001356Homeobox domain
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.605.3E-4147189IPR009057Homeodomain-like
PROSITE profilePS5084841.511296529IPR002913START domain
SuperFamilySSF559611.22E-36298528No hitNo description
CDDcd088752.05E-124300525No hitNo description
SMARTSM002341.3E-60305526IPR002913START domain
PfamPF018521.8E-53306526IPR002913START domain
Gene3DG3DSA:3.30.530.205.7E-6367522IPR023393START-like domain
SuperFamilySSF559618.79E-12547636No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MMIPARHMPP MIGRSSAAAA YGSSSALSLG QPNLLDNHPQ LQQALQQHHL LDQIPATTAE  60
SGDNMMRGGR SSDLLGDEFE SKSGSENVDG VSVDDQDPNQ PPSKKKRYHR HTQHQIQEME  120
SFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK NQHERQENSQ LRAENEKLRA  180
ENMRYKEALS SASCPNCGGP AALGEMSFDE HHLRIENARL HEEIDRISAI AAKYVGKPMV  240
SFPVLSSPLA AARASPLDIG VGAAAAAAAA AYGVTDIFGG VAAGAAGELL RGAAQSGADK  300
PMIVELAVAA MEELVQMAQL DEPLWNAPGV DGSIETLNEE EYSRMFSRGL GPKQYGLKSE  360
ASRDSSVVIM THANLVEILM DVNQYATMFS SIVSRAATLE VLSTGVAGNY NGALQVMSVE  420
FQVPSPLVPT RESYFVRYCK QNADGTWAVV DVSLDSLRPG SVLKCRRRPS GCLIQEMPNG  480
YSKVTWVEHV EVDDRSVHNI YKLLVNSGLA FGARRWVGTL DRQCERLASV MASNIPTSDI  540
GVITSSEGRK SMLKLAERMV MSFCGGVTAS AAHQWTTLSG SGAEDVRVMT RKSVDDPGRP  600
PGIVLNAATS FWLPVPPKRV FDFLRDESSR SEWDILSNGG IVQKMAHIAN AGIMATVSRS  660
SCQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976894.10.0PREDICTED: homeobox-leucine zipper protein ROC2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLK3Y5C10.0K3Y5C1_SETIT; Uncharacterized protein
STRINGSi009409m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein